PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.11G148000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 844aa    MW: 93423.5 Da    PI: 7.5349
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.11G148000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.2e-096366731954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  Manes.11G148000.1.p 636 FEHflHPYPTDTDKHMLAAQTGLSRNQVSNWFINARVR 673
                          564459******************************88 PP

2BELL101.84.9e-33491560372
                 BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                           e q+kkakLl l+eeV++rYkqy++q+q+v+ssFe vagl +a+pY+slAlk++S++Fr Lk ai++q+
  Manes.11G148000.1.p 491 PEYQQKKAKLLYLQEEVCRRYKQYHQQMQMVASSFESVAGLSAATPYVSLALKTVSKNFRFLKHAISDQL 560
                          589****************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.4E-46406558IPR006563POX domain
PfamPF075261.9E-43411557IPR006563POX domain
PROSITE profilePS5007111.953614677IPR001356Homeobox domain
SMARTSM003892.8E-9617681IPR001356Homeobox domain
CDDcd000863.34E-12617678No hitNo description
SuperFamilySSF466894.02E-17619684IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.6E-28620683IPR009057Homeodomain-like
PfamPF059202.0E-18634673IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 844 aa     Download sequence    Send to blast
MDASSFRPGE SHVAQQSRRD KLRVQASSTS VHQLDDFHNN LEQLLVHSGL NPELVQVRNV  60
RKANVLYDPT TTTVFSSEML NFASTSNNVL LSQGDAAMID HELDAVQSSR LIPEISSYSN  120
TSHPISSNFN ASPRASPSDP QGYTNWRSND SQQSYDCMVN YASGSVGRKN NQKPIFVGDV  180
LSNNARVTNS STPTQYLKPN YNGYQNVQSS LANPSSEIPV HDSQKHHTEI QFSSNMHPLY  240
QNTLVDVVTS AASIGGNERI LLPAYGNQST PFYFDNANSS MNRPVDNSHL WSSELGFIAR  300
KNDQELRTLA SDPNTQVLSL SLSSNPPSRG NLTQFGEGYE SANLQSKSSV LEERHQDSKL  360
VKSNYLCPMS KPVAINSKGS GKSINDLAGA PNYNVLRNAG PLGPFTGYAT ILTSSRFLKP  420
AQQLLDEFCS ATGSKFMKAC EGSGGMSEAD AETGTKGNNN SSSVSSMTFY GSNEASGDVA  480
VASNSCESYR PEYQQKKAKL LYLQEEVCRR YKQYHQQMQM VASSFESVAG LSAATPYVSL  540
ALKTVSKNFR FLKHAISDQL KHVIKALGED LLSPNTNASS SKGDTSTSRL RCMDPSFQRN  600
KSSGANVGFF EPQQHIWRPQ RGLPERSVAI LRAWLFEHFL HPYPTDTDKH MLAAQTGLSR  660
NQVSNWFINA RVRLWKPMVE EMHMLETKGL AENQTYMNNL EGKRAEGTSQ PYEQPSNNTG  720
ASYMLNKQIE CSGTVSSDGS GEKLEAEQWS REKRSRIEFQ NPTRMDGAVM DFLPYQRSGI  780
EVGGLGAVSL TLGLRHGVEN AHQQQQQQQQ QQQQQRQLQL QQHEDQLRRQ FGGQMIHDFV  840
GCS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-15623681563Homeobox protein Meis2
3k2a_B3e-15623681563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002529426.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLB9STV70.0B9STV7_RICCO; Bel1 homeotic protein, putative
STRINGPOPTR_0009s01520.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34813257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.16e-95BEL1-like homeodomain 8